top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|59188117|59218087|-|9|circRNA|MYO1E|ENST00000288235.8|18,17,16,15,14,13,12,11,10

MYO1E

Open Reading Frame (ORF)

LGLKENIRVRRAGYAYRRIFQKFLQSFSFSCISARDKPGPVERKANKPADG

Peptide

DKPGPVERK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page