top of page

CircRNA

Gene

chr15|59153589|59163303|-|4|circRNA|MYO1E|ENST00000288235.8|26,25,24,23

MYO1E

CircRNA UID

circMYO1E(26,25,24,23)

Open Reading Frame (ORF)

MCHIPMLLEARGPIRKACTPPWPARPCLGSSLPVQTECHRRQRAWISSRSRTRELQVLCRMTFLFSMSKSMTVCLNLSSKLNS

Peptide

ACTPPWPARPCLGSSLPVQTECHR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page