top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|58888384|58901287|—|12|circRNA|SLTM|ENST00000380516.6|17,16,15,14,13,12,11,10,9,8,7,6

SLTM

Open Reading Frame (ORF)

MHDLAMDPTTLANRTDLMTLITERGAGFLRVQQYSLHLLKGW

Peptide

MHDLAMDPTTLANRTDLMTLITER

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page