top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|58640776|58717727|—|7|circRNA|ADAM10|ENST00000260408.7|8,7,6,5,4,3,2

ADAM10

Open Reading Frame (ORF)

LSRIMMTTVWPMSSQTEILMMAYLVWLGLEHLQVSMGIL

Peptide

IMMTTVWPMSSQTEILMMAYLVWLGLEHLQVSMGIL

ORF Found in Long-Read

false

Peptide Length

36

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

31

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page