top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|58610296|58633359|—|6|circRNA|ADAM10|ENST00000260408.7|14,13,12,11,10,9

ADAM10

Open Reading Frame (ORF)

LQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVEALEEYVKKVNSIQMVRRSP

Peptide

VNSIQMVRR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page