top of page

CircRNA

Gene

chr15|57437984|57442478|+|3|circRNA|CGNL1|ENST00000281282.5|2,3,4

CGNL1

CircRNA UID

circCGNL1(2,3,4)

Open Reading Frame (ORF)

LPTAHMPTLKPRKPGQMFFPSGDRIQRDPSWMELGPGGPPRHPQLPRQPTLCTGFYWMIRNVPSMPTTSIVMKTEGIFPSCQELDGILIQDQFLVWIS

Peptide

DPSWMELGPGGPPRHPQLPR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page