top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|52214602|52237646|-|12|circRNA|MYO5C|NM_018728|33,32,31,30,29,28,27,26,25,24,23,22

MYO5C

Open Reading Frame (ORF)

MKDRVIKKLQDQVKTLSKTIGKEQRKPWAGGEAD

Peptide

EQRKPWAGGEAD

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page