top of page

CircRNA

Gene

chr15|51887588|51893945|+|3|circRNA|TMOD3|NM_014547|4,5,6

TMOD3

Open Reading Frame (ORF)

LKRTKENDAHLVEVNLNNIKGKYLSPNRNLYRLLQKKKCLLIQN

Peptide

GKYLSPNR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page