top of page

CircRNA

Gene

chr15|50725220|50748870|-|10|circRNA|SPPL2A|ENST00000261854.9|12,11,10,9,8,7,6,5,4,3

SPPL2A

CircRNA UID

circSPPL2A(12,11,10,9,8,7,6,5,4,3)

Open Reading Frame (ORF)

LPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPDFH

Peptide

LIYFSVMSVCLMPVSILGFGDIIVPDFH

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page