top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|49011730|49028682|—|9|circRNA|SECISBP2L|ENST00000559471.5|13,12,11,10,9,8,7,6,5

SECISBP2L

Open Reading Frame (ORF)

LMTCHRRLFPRKISHQISLTSLSQRPLQQCSGSPRAGEEEHPTLLLNLLVSRGLVKPTLTVIVVTAVPNTATTSLQQGL

Peptide

LMTCHRR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page