top of page

CircRNA

Gene

chr15|44613429|44615566|-|2|circRNA|SPG11|ENST00000261866.11|17,16

SPG11

Open Reading Frame (ORF)

LEKKELHEAHPWFEFLVQCRQVASNLTGMGFFWHLNWKTLNASS

Peptide

QVASNLTGMGFFWHLNWK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page