top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|44569397|44572820|-|3|circRNA|SPG11|ENST00000261866.11|35,34,33

SPG11

Open Reading Frame (ORF)

MTYIFDLLHKKHYFEVLMRKKLDPDISRCSTQQRKARHFFS

Peptide

KLDPDISR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page