top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|43415593|43480017|—|18|circRNA|TP53BP1|ENST00000382044.8|23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6

TP53BP1

Open Reading Frame (ORF)

LILPHHSWVLGFWNSPRARMLRKILCHMKWTKSSYNQ

Peptide

LILPHHSWVLGFWNSPR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page