top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|43377846|43383504|+|3|circRNA|TUBGCP4|NM_001286414|5,6,7

TUBGCP4

Open Reading Frame (ORF)

MGSCINSSQPGCSMDSSWTSMKNSLSNRGHLLVMSVPSQKRTRRIWALGD

Peptide

GHLLVMSVPSQK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page