top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|43146492|43149151|+|3|circRNA|TMEM62|NM_024956|5,6,7

TMEM62

Open Reading Frame (ORF)

LFCTLVTSRALWNLRWETGRIIGGNILLYVEMALSIMSTVLPLATIRSSV

Peptide

LFCTLVTSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page