top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|43048391|43068036|-|8|circRNA|UBR1|ENST00000290650.8|13,12,11,10,9,8,7,6

UBR1

Open Reading Frame (ORF)

LISKPTIWTERLRMQFLEGFRSFLKILTCMQGEK

Peptide

SFLKILTCMQGEK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page