top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|43043214|43056442|-|5|circRNA|UBR1|ENST00000290650.8|15,14,13,12,11

UBR1

Open Reading Frame (ORF)

MRCSTSFISSSKTVVQSCGHSLETKSYRVSEDLVSIHLPLSRTLAVL

Peptide

VSEDLVSIHLPLSRTLAVL

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page