top of page

CircRNA

Gene

chr15|42448071|42451954|—|2|circRNA|ZNF106|NM_022473|3,2

ZNF106

Open Reading Frame (ORF)

MHRLMTLLNLMYLMKQKALRVLAWMQSFKKVTSVSPRALSCLN

Peptide

MHRLMTLLNLMYLMK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page