top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|41919209|41953940|-|3|circRNA|EHD4|ENST00000220325.8|4,3,2

EHD4

Open Reading Frame (ORF)

LQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKIPTGAGFPRHEDWSGAHHRLLHRRDVWRD

Peptide

LAKIPTGAGFPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page