top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|41520390|41521147|-|1|circRNA|RPAP1|ENST00000565167.1|2

RPAP1

Open Reading Frame (ORF)

LPGPPQHPQLLPDSLLASPSQSAGLPGSAPRGATASPNPATAHAYGAAAAHRLALPATDSPLPPGFRHPLGTLSHRHHGHSHAGPAVGASFGELAPPGSLGCAPCCPPGTAHVCVPGGQ

Peptide

LALPATDSPLPPGFR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page