top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|41047407|41056706|—|7|circRNA|INO80|ENST00000361937.7|23,22,21,20,19,18,17

INO80

Open Reading Frame (ORF)

MKKAVSLSFALLIYLQQKWQTLCFRDFWPVFVGRSSYSSSVGIGFC

Peptide

AVSLSFALLIYLQQK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page