top of page

CircRNA

Gene

chr15|40737123|40745259|-|8|circRNA|RMDN3|NM_001304802|12,11,10,9,8,7,6,5

RMDN3

CircRNA UID

circRMDN3(12,11,10,9,8,7,6,5)

Open Reading Frame (ORF)

MVDEVGPGAARCHEGVTQQPMRSLTMSGTLTKKVRTGKMK

Peptide

CHEGVTQQPMRSLTMSGTLTK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

14

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page