top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|33153047|33155045|—|1|circRNA|FMN1|NM_001277313|4

FMN1

Open Reading Frame (ORF)

MKPLRGKDWASLSTRVSLTLAQKRETRGEPGCPLVATSPCFWICPTK

Peptide

VSLTLAQKR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page