top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|30908117|30920653|+|5|circRNA|FAN1|NM_014967|3,4,5,6,7

FAN1

Open Reading Frame (ORF)

LLGGFIQGFCLGLWKYCRDFTCMSYWSEVICKALST

Peptide

LLGGFIQGFCLGLWKYCR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page