top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|29737263|29772166|—|8|circRNA|TJP1|NM_001301026|12,11,10,9,8,7,6,5

TJP1

Open Reading Frame (ORF)

MKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRGK

Peptide

EGLEEGDQILRGK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page