top of page

CircRNA

Gene

chr15|29726780|29742781|-|9|circRNA|TJP1|NM_001301026|18,17,16,15,14,13,12,11,10

TJP1

CircRNA UID

circTJP1(18,17,16,15,14,13,12,11,10)

Open Reading Frame (ORF)

MRMRLCPESRKSARKLYERSHKLRKNNHHLFTISGVEMKREFLNLGLSQLL

Peptide

NNHHLFTISGVEMK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page