top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|25354352|25371812|—|6|circRNA|UBE3A|ENST00000614096.4|11,10,9,8,7,6

UBE3A

Open Reading Frame (ORF)

LMMCLWILMPLEGSTPDCSLMKKLKLPFSMHLYICHLTWNVT

Peptide

LKLPFSMHLYICHLTWNVT

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page