top of page

CircRNA

Gene

chr15|24981774|24982437|+|1|circRNA|SNURF|ENST00000551312.6|6

SNURF

Open Reading Frame (ORF)

LLVAQIPFFICIDILSSFFFLHVVRCRKLKGNLSLDHGRQRHLVRWKQGCVKMRRPPLGLKKKSARVLGF

Peptide

GNLSLDHGR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page