top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|23000568|23006352|-|6|circRNA|TUBGCP5|ENST00000614508.4|22,21,20,19,18,17

TUBGCP5

Open Reading Frame (ORF)

MESIEKMESDFKNCHMFLVTILNKAVCRGSFPHFYLYLLKMLTQLRRSCLFIS

Peptide

MLTQLRR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page