top of page

CircRNA

Gene

chr15|100261478|100331054|-|4|circRNA|ADAMTS17|NM_139057|6,5,4,3

ADAMTS17

CircRNA UID

circADAMTS17(6,5,4,3)

Open Reading Frame (ORF)

LGTMVSGPWRASVTGRTRSMEERDTSAITRFPAGRTTRPWWMLPCL

Peptide

LGTMVSGPWRASVTGR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page