top of page

CircRNA

Gene

chr15|100254135|100281401|-|4|circRNA|ADAMTS17|NM_139057|7,6,5,4

ADAMTS17

CircRNA UID

circADAMTS17(7,6,5,4)

Open Reading Frame (ORF)

MNRVTLLKRRSRRGAGLRGTGGSGGTLSGSPASTRWRPWWWPTPTWCSTTGPRPPRGSS

Peptide

GTGGSGGTLSGSPASTR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page