top of page

CircRNA

Gene

chr15|100152611|100155320|-|2|circRNA|ADAMTS17|NM_139057|10,9

ADAMTS17

CircRNA UID

circADAMTS17(10,9)

Open Reading Frame (ORF)

LLASHGPQKPAHSTPPAQAAGHALQCQRAVPDPVWHECHLLQKHGAWA

Peptide

AVPDPVWHECHLLQKHGAWA

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page