top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|100152611|100155320|—|2|circRNA|ADAMTS17|NM_139057|10,9

ADAMTS17

Open Reading Frame (ORF)

LLASHGPQKPAHSTPPAQAAGHALQCQRAVPDPVWHECHLLQKHGAWA

Peptide

AVPDPVWHECHLLQKHGAWA

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page