top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|99406515|99458535|—|4|circRNA|SETD3|ENST00000331768.9|9,8,7,6

SETD3

Open Reading Frame (ORF)

LVTTWKMTAVSVWLCRIFGLESRALIFSRPNPSSHGKHRTGLSFAV

Peptide

TGLSFAV

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page