top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|95124195|95131639|—|5|circRNA|DICER1|NM_001195573|7,6,5,4,3

DICER1

Open Reading Frame (ORF)

MSDSSLKALSGIIIEIRIIMCHGVILRMMMRMKKLKKKRSQRQIFLLLLPTFCAELFLWKEDTQQLS

Peptide

ALSGIIIEIR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page