top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|91993808|92006448|—|5|circRNA|TRIP11|ENST00000267622.8|15,14,13,12,11

TRIP11

Open Reading Frame (ORF)

LLLPRKQLLSNCKMKIKNCPLDLKVVAKICLEKLFRIYHVSFEKKTSK

Peptide

IKNCPLDLK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page