top of page

CircRNA

Gene

chr14|91289104|91294318|—|3|circRNA|CCDC88C|NM_001080414|25,24,23

CCDC88C

Open Reading Frame (ORF)

LDWSQSLSQTHQTKERGFEGTLKIHRGQPSLAAGVLRPRLAGGLSAAQITGREPRHPRTGLQLCRRARRPQRVCGESCSPVSRGTWRKKIITS

Peptide

LAGGLSAAQITGREPR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page