top of page

CircRNA

Gene

chr14|90676522|90689712|-|3|circRNA|TTC7B|ENST00000328459.10|9,8,7

TTC7B

CircRNA UID

circTTC7B(9,8,7)

Open Reading Frame (ORF)

LNTRVTASSVCRVHLWSMTYSPLLLEEEASMRCCQRQ

Peptide

VTASSVCR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page