top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|88574692|88609803|+|9|circRNA|ZC3H14|NM_001160103|7,8,9,10,11,12,13,14,15

ZC3H14

Open Reading Frame (ORF)

LHHQHHLPVVSSAVTSLLVRRWNVPSIIQKMKTFGRESCLW

Peptide

LHHQHHLPVVSSAVTSLLVR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page