top of page

CircRNA

Gene

chr14|77576766|77579109|-|2|circRNA|SPTLC2|NM_004863|4,3

SPTLC2

CircRNA UID

circSPTLC2(4,3)

Open Reading Frame (ORF)

MGSYNYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGLCVIVSRF

Peptide

QEIGLCVIVSRF

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page