top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|77296163|77298771|—|2|circRNA|POMT2|NM_013382|9,8

POMT2

Open Reading Frame (ORF)

LAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQWPW

Peptide

HLYPEGIGARQQQWPW

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page