top of page

CircRNA

Gene

chr14|75863666|75902224|+|2|rescued|TTLL5|ENST00000557636|156,46|0,38512

TTLL5

Open Reading Frame (ORF)

LQPLCPSPALQEPADRGICLGRRSRKQRVQPGYRGGPPAQVSPHSRQLSASICPAAT

Peptide

GGPPAQVSPHSR

ORF Found in Long-Read

true

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page