top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|75109684|75121174|—|8|circRNA|NEK9|ENST00000238616.9|10,9,8,7,6,5,4,3

NEK9

Open Reading Frame (ORF)

MFGVVENPPPRNWMLSRVAVVPGRSVQGIPTLLWSQWRRNCTLGWREPV

Peptide

NCTLGWR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page