top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|75109684|75110371|—|2|circRNA|NEK9|ENST00000238616.9|10,9

NEK9

Open Reading Frame (ORF)

MFGVVENPPPRNWMLSRVAVVPGRSVQGIPTLLWSQWRRNCTLG

Peptide

MFGVVENPPPR

ORF Found in Long-Read

true

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page