top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|74809379|74829343|+|13|circRNA|YLPM1|ENST00000552421.5|6,7,8,9,10,11,12,13,14,15,16,17,18

YLPM1

Open Reading Frame (ORF)

LVLKGNVTGRPLPAEWRIIFSSPMIMILVLLSLGRRGLQGRIDLPLLWANHQVQL

Peptide

GNVTGRPLPAEWR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page