top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|74663898|74692328|-|18|circRNA|AREL1|ENST00000557401.5|19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

AREL1

Open Reading Frame (ORF)

MDPGASFGSRLHPALERSPGMIYSWAVFLYPGVHPVHPRNTDLITVTKSDG

Peptide

NTDLITVTK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page