top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|73983017|74015930|—|5|circRNA|ENTPD5|ENST00000334696.10|6,5,4,3,2

ENTPD5

Open Reading Frame (ORF)

LSFPCSWSTKKCGVSWLNPHTDKIIMVLLGRTCIQM

Peptide

IIMVLLGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page