top of page

CircRNA

Gene

chr14|73973024|73973876|-|1|ciRNA|ENTPD5|ENST00000557325.5|12

ENTPD5

Open Reading Frame (ORF)

MFFHWLKLRLQWKLWKSPMGNFFQNSREAYLVAGTYSKDLGMPPRTNVK

Peptide

EAYLVAGTYSKDLGMPPR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page