top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|73719304|73721509|—|2|circRNA|ELMSAN1|ENST00000423556.5|11,10

ELMSAN1

Open Reading Frame (ORF)

LGLPVARPRRSQGKGQGSHEGHYLFQRRRKKQRHSVRPRIRRTLSPVKNVADFPKVPKGASSQKRVPK

Peptide

NVADFPK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page