top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|70761001|70801080|—|2|circRNA|MAP3K9|ENST00000554752.6|3,2

MAP3K9

Open Reading Frame (ORF)

LILQKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSVRN

Peptide

ASMFSKGSDVWSVR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page